HPA049693

NOL7 antibody from Atlas Antibodies
C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1

Antibody data

Product number
HPA049693
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049693, RRID:AB_2680853
Product name
Anti-NOL7
Provider product page
Atlas Antibodies - HPA049693
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVS
QNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPG
TNRTTVNKFL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.