HPA011169

KIAA0319L antibody from Sigma-Aldrich
KIAA1837
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011169
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011169, RRID:AB_1852301
Product name
Anti-KIAA0319L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011169
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0319-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGKTQFGVGLRSGGENHLWLLEGTPSLQSCWAACC
QDSACHVFWWLEGMCIQADCSRPQSCRAFRTHSSN
SMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWAS
WRQSPPRAALRPAVSSSDQQSLIRKLQKRGSPSDV
VTPI
Storage
-20C
Provider Type Product Number
- No reagents -