HPA001077

TRMT2A antibody from Sigma-Aldrich
HTF9C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001077
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001077, RRID:AB_1079092
Product name
Anti-HTF9C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001077
Antibody type
Polyclonal
Antigen
tRNA recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTL
VSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLR
RLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPV
KAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPH
SPPAQPTPGPPDNTLQETGT
Storage
-20C
Provider Type Product Number
- No reagents -