HPA013434

FAM171B antibody from Sigma-Aldrich
FLJ34104, KIAA1946
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013434
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013434, RRID:AB_2262499
Product name
Anti-FAM171B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013434
Antibody type
Polyclonal
Antigen
Protein FAM171B precursor
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEDTVLITGKLADAKSQPSVQFSKALIKLPDNHHI
SNVTGYLTVLQQFLKVDNFLHTTGITLNKPGFENI
ELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRLN
DISAGDRIPAWTFDMNTGAWVNHGRGM
Storage
-20C
Provider Type Product Number
- No reagents -