H00029951-B01P

PDZRN4 antibody from Abnova Corporation
DKFZp434B0417, FLJ33777, IMAGE5767589, LNX4

Antibody data

Product number
H00029951-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029951-B01P, RRID:AB_1578605
Product name
PDZRN4 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00029951-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PDZRN4 protein.
Antigen sequence
MGCNLCTFQKREEHYKLLYEVSQVNGKDLSKATHE
EAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQ
LMNASTQTDITFEHIMALAKLRPPTPPVPDICPFL
LSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDF
EYEEVELCRVSSQEKLGLTVCYRTDDEEDTGIYVS
EVDPNSIAAKDGRIREGDRILQINGEDVQNREEAV
ALLSNDECKRIVLLVARPEIQLDEGWLEDERNEFL
EELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGT
TDTATSSSNNHEKDSGVGRTDESLRNDESSEQENA
AEDPNSTSLKSKRDLGQSQDTLGSVELQYNESLVS
GEYIDSDCIGNPDEDCERFRQLLELKCKIRNHGEY
DLYYSSSTIECNQGEQEGVEHELQLLNEELRNIEL
ECQNIMQAHRLQKVTDQYGDIWTLHDGGFRNYNTS
IDMQRGKLDDIMEHPEKSDKDSSSAYNTAESCRST
PLTVDRSPDSSLPRVINLTNKKNLRSTMAATQSSS
GQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPD
QEKAVSEHIPYLSPYHSSSYRYANIPAHARHYQSY
MQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKME
WKVKIRSDGTRYITKRPVRDRILKERALKIKEERS
GMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRR
RREFMMRSRLECLKESPQSGSEGKKEINIIELSHK
KMMKKRNKKILDNWMTIQELMTHGAKSPDGTRVHN
AFLSVTTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -