HPA028053

DTNBP1 antibody from Sigma-Aldrich
BLOC1S8, DBND, Dysbindin, HPS7, My031
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028053
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028053, RRID:AB_10599296
Product name
Anti-DTNBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028053
Antibody type
Polyclonal
Antigen
dystrobrevin binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVELQEQLQQLPALIADLESMTANLTHLEASFEEV
ENNLLHLEDLCGQCELERCKHMQSQQLENYKK
Storage
-20C
Provider Type Product Number
- No reagents -