ABIN630341

antibody from antibodies-online

Targeting: SRPRB APMCF1, SR-beta

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630341 - Provider product page
Provider: antibodies-online
Product name: anti-Signal Recognition Particle Receptor, B Subunit (SRPRB) (C-Term) antibody
Antibody type: Polyclonal
Antigen: SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: C-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

SRPRB protein structure - ABIN630341 shown in red.