AV49643

SRPRB antibody from Sigma-Aldrich
APMCF1, SR-beta
No application information provided.

Antibody data

Product number
AV49643
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV49643, RRID:AB_1857482
Product name
Anti-SRPRB (AB1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV49643
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SRPRB with an internal ID of Y02721
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPST
LYSSSTAPAQLGKKG
Storage
-20C
Provider Type Product Number
- No reagents -