HPA011173

SRPRB antibody from Sigma-Aldrich
APMCF1, SR-beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011173
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011173, RRID:AB_1857484
Product name
Anti-SRPRB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011173
Antibody type
Polyclonal
Antigen
Signal recognition particle receptor subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVN
NNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVF
VVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFL
IACNKQDIAMAKSAKLIQQQLEKELNTL
Storage
-20C
Provider Type Product Number
- No reagents -