H00023213-M01A

SULF1 antibody from Abnova Corporation
hSulf-1, KIAA1077, SULF-1
No application information provided.

Antibody data

Product number
H00023213-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023213-M01A, RRID:AB_1581103
Product name
SULF1 monoclonal antibody (M01A), clone 1A4
Provider product page
Abnova Corporation - H00023213-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SULF1.
Antigen sequence
RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTV
HTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLD
VGNKDGGSYDLHRGQLWDGWEG
Isotype
IgM
Antibody clone number
1A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -