ABIN632474

antibody from antibodies-online

Targeting: RSL24D1 C15orf15, HRP-L30-iso, L30, RPL24, RPL24L

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632474 - Provider product page
Provider: antibodies-online
Product name: anti-Ribosomal L24 Domain Containing 1 (RSL24D1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

RSL24D1 protein structure - ABIN632474 shown in red.