ABIN632474
antibody from antibodies-online
Targeting: RSL24D1
C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN632474 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ribosomal L24 Domain Containing 1 (RSL24D1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data