H00085437-B01

ZCRB1 antibody from Abnova Corporation
MADP-1, MADP1, RBM36, SNRNP31, ZCCHC19

Antibody data

Product number
H00085437-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00085437-B01, RRID:AB_1138582
Product name
ZCRB1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00085437-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZCRB1 protein.
Antigen sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGK
VVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA
INNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKS
KCYECGESGHLSYACPKNMLGEREPPKKKEKKKKK
KAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQ
AKIEEEQKKWKPSSGVPSTSDDSRRPRIKKSTYFS
DEEELSD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -