HPA011175

MANF antibody from Sigma-Aldrich
ARMET, ARP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011175
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011175, RRID:AB_1845039
Product name
Anti-ARMET antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011175
Antibody type
Polyclonal
Antigen
Protein ARMET precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEVCISYLGRFYQDLKDRDVTFSPATIENELIKFC
REAR
Storage
-20C
Provider Type Product Number
- No reagents -