HPA011392

SDK1 antibody from Atlas Antibodies
FLJ31425
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011392
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011392, RRID:AB_1235499
Product name
Anti-SDK1
Provider product page
Atlas Antibodies - HPA011392
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ICNKYNGAVLTESVSLKEKSADASESEATDSDYED
ALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRY
EAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTP
LTGFSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -