HPA011392

SDK1 antibody from Sigma-Aldrich
FLJ31425
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011392
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011392, RRID:AB_1856648
Product name
Anti-SDK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011392
Antibody type
Polyclonal
Antigen
Protein sidekick-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ICNKYNGAVLTESVSLKEKSADASESEATDSDYED
ALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRY
EAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTP
LTGFSS
Storage
-20C
Provider Type Product Number
- No reagents -