HPA030464

SUSD6 antibody from MilliporeSigma / Merck KGaA
KIAA0247
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030464
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030464, RRID:AB_10601128
Product name
Anti-KIAA0247 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030464
Antibody type
Polyclonal
Antigen
KIAA0247 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGGYICHPRPCRDPLTAGSVIEYLCAEGYMLKGDY
KYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTL
S
Storage
-20C
Provider Type Product Number
- No reagents -