Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010932 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010932, RRID:AB_1079422
- Product name
- Anti-MTDH
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGI
GSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNG
LSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPI
PDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGE
DNSTAQD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Astrocyte elevated gene-1 regulates osteosarcoma cell invasion and chemoresistance via endothelin-1/endothelin A receptor signaling.
Liu B, Wu Y, Peng D
Oncology letters 2013 Feb;5(2):505-510
Oncology letters 2013 Feb;5(2):505-510
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-MTDH antibody HPA010932 (A) shows similar pattern to independent antibody HPA015104 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN