HPA010932

MTDH antibody from Atlas Antibodies
3D3, AEG-1, LYRIC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010932
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010932, RRID:AB_1079422
Product name
Anti-MTDH
Provider product page
Atlas Antibodies - HPA010932
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGI
GSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNG
LSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPI
PDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGE
DNSTAQD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -