HPA015104

MTDH antibody from Sigma-Aldrich
3D3, AEG-1, LYRIC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015104
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015104, RRID:AB_1854173
Product name
Anti-MTDH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015104
Antibody type
Polyclonal
Antigen
Protein LYRIC recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLT
DSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKN
KGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVN
GGGWNEKSVKLSSQISAGEEKWNSVSPA
Storage
-20C
Provider Type Product Number
- No reagents -