Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004712-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004712-D01, RRID:AB_10717604
- Product name
- NDUFB6 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
- Antigen sequence
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVL
PPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIF
VFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIF
PGDTILETGEVIPPMKEFPDQHH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NDUFB6 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody.Lane 1: NDUFB6 transfected lysate(15.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NDUFB6 transfected lysate using anti-NDUFB6 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NDUFB6 purified MaxPab mouse polyclonal antibody (B01P) (H00004712-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol