HPA017245

LRP12 antibody from Sigma-Aldrich
FLJ12929, ST7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017245
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017245, RRID:AB_1857532
Product name
Anti-LRP12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017245
Antibody type
Polyclonal
Antigen
Low-density lipoprotein receptor-related protein 12 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGR
SSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQS
TSREPERNHTHRSLFSVESDDTDTENERRDMAGAS
GGVAAPLPQKVPPTTAVEATVGACASSS
Storage
-20C
Provider Type Product Number
- No reagents -