HPA017245

LRP12 antibody from Atlas Antibodies
FLJ12929, ST7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017245
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017245, RRID:AB_1857532
Product name
Anti-LRP12
Provider product page
Atlas Antibodies - HPA017245
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGR
SSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQS
TSREPERNHTHRSLFSVESDDTDTENERRDMAGAS
GGVAAPLPQKVPPTTAVEATVGACASSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -