HPA034617

ZNF846 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034617
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034617, RRID:AB_10603942
Product name
Anti-ZNF846 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034617
Antibody type
Polyclonal
Antigen
zinc finger protein 846 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEKLYDSNHSGKVFNEHPFLMTHMITHIGEKTSED
NQSGKALRKNFPHSFYKKSHAEGKMPKCVKHE
Storage
-20C
Provider Type Product Number
- No reagents -