HPA011419

STOM antibody from Sigma-Aldrich
BND7, EPB7, EPB72
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011419
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011419, RRID:AB_1080109
Product name
Anti-STOM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011419
Antibody type
Polyclonal
Antigen
Erythrocyte band 7 integral membrane protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPP
QEILTKDSVTISVDGVVYYRVQNATLAVANITNAD
SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQ
STLDDATDA
Storage
-20C
Provider Type Product Number
- No reagents -