Antibody data

Product number
H00160287-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00160287-B01, RRID:AB_1114157
Product name
LDHAL6A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00160287-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LDHAL6A protein.
Antigen sequence
MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVAC
AISILLKGLSDELVLVDVDEGKLKGETMDLQHGSP
FMKMPNIVSSKDYLVTANSNLVIITAGARQKKGET
RLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPV
DILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIG
QRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVP
LKDLNPDIGTDKDPEQWENVHKKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.