Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002138-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002138-A01, RRID:AB_563241
- Product name
- EYA1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant EYA1.
- Antigen sequence
TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPY
GISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTS
F- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gene signatures associated with mouse postnatal hindbrain neural stem cells and medulloblastoma cancer stem cells identify novel molecular mediators and predict human medulloblastoma molecular classification.
Eyes absent 1 (Eya1) is a critical coordinator of epithelial, mesenchymal and vascular morphogenesis in the mammalian lung.
Corno D, Pala M, Cominelli M, Cipelletti B, Leto K, Croci L, Barili V, Brandalise F, Melzi R, Di Gregorio A, Sergi LS, Politi LS, Piemonti L, Bulfone A, Rossi P, Rossi F, Consalez GG, Poliani PL, Galli R
Cancer discovery 2012 Jun;2(6):554-68
Cancer discovery 2012 Jun;2(6):554-68
Eyes absent 1 (Eya1) is a critical coordinator of epithelial, mesenchymal and vascular morphogenesis in the mammalian lung.
El-Hashash AH, Al Alam D, Turcatel G, Bellusci S, Warburton D
Developmental biology 2011 Feb 1;350(1):112-26
Developmental biology 2011 Feb 1;350(1):112-26
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EYA1 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of EYA1 expression in Jurkat ( Cat # L017V1 ).