Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001063 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001063, RRID:AB_1078297
- Product name
- Anti-BRD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYP
SYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGE
HMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGI
DETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRV
HGEPTSD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Scalable In Situ Hybridization on Tissue Arrays for Validation of Novel Cancer and Tissue-Specific Biomarkers
Kiflemariam S, Andersson S, Asplund A, Pontén F, Sjöblom T, Srivastava R
PLoS ONE 2012 March;7(3)
PLoS ONE 2012 March;7(3)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in seminiferus ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN