HPA000807

BRD1 antibody from Sigma-Aldrich
BRL, BRPF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000807
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000807, RRID:AB_1078298
Product name
Anti-BRD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000807
Antibody type
Polyclonal
Antigen
Bromodomain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKD
PARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLE
AQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAA
VRLRDQGGVV
Storage
-20C
Provider Type Product Number
- No reagents -