HPA001063

BRD1 antibody from Sigma-Aldrich
BRL, BRPF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001063
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001063, RRID:AB_1078297
Product name
Anti-BRD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001063
Antibody type
Polyclonal
Antigen
Bromodomain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYP
SYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGE
HMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGI
DETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRV
HGEPTSD
Storage
-20C
Provider Type Product Number
- No reagents -