HPA011635

ST8SIA6 antibody from Sigma-Aldrich
SIAT8F
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011635
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011635, RRID:AB_2194921
Product name
Anti-ST8SIA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011635
Antibody type
Polyclonal
Antigen
alpha-2,8-Sialyltransferase 8F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RILVEESREATHGTPAALRTLRSPATAVPRATNST
YLNEKSLQLTEKCKNLQYGIESFSNKTKGYSENDY
LQIITDIQSCPWKRQAEEYANFRAKLASCCDAVQN
FVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFP
VSQP
Storage
-20C
Provider Type Product Number
- No reagents -