HPA027608

ADAMTS20 antibody from Sigma-Aldrich
GON-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027608
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027608, RRID:AB_10600098
Product name
Anti-ADAMTS20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027608
Antibody type
Polyclonal
Antigen
ADAM metallopeptidase with thrombospondin type 1 motif, 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPE
VRPLMEQECSLAACPPAHSHFPSSPVQPSYYLSTN
LPLTQKLEDNENQVVHPSVRGNQWRTG
Storage
-20C
Provider Type Product Number
- No reagents -