Antibody data

Product number
H00026108-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026108-M13, RRID:AB_1579449
Product name
PYGO1 monoclonal antibody (M13), clone 3E1
Provider product page
Abnova Corporation - H00026108-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PYGO1.
Antigen sequence
YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNP
LGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVN
MPNQHFRQNPAENFSQIPPQNASQVSNPDL
Isotype
IgG
Antibody clone number
3E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -