H00080013-B01

MINDY3 antibody from Abnova Corporation
C10orf97, CARP, DERP5, FAM188A, FLJ13397, my042

Antibody data

Product number
H00080013-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080013-B01, RRID:AB_1137819
Product name
C10orf97 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00080013-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C10orf97 protein.
Antigen sequence
MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVF
SESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE
KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSY
CLVSWLRGKTTEETASISGSPAESSCQVEHSSALA
VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMW
GNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID
PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKL
LGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW
IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTY
DPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK
LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHY
NGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP
IKRCLQTKWPYIELLWTTDRSPSLN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -