HPA000866

COX16 antibody from Sigma-Aldrich
C14orf112, HSPC203
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000866, RRID:AB_2276678
Product name
Anti-SYNJ2BP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000866
Antibody type
Polyclonal
Antigen
COX16-like protein C14orf112, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYV
SNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQ
DLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGP
IGHRGEG
Storage
-20C
Provider Type Product Number
- No reagents -