HPA012164

CDH22 antibody from Atlas Antibodies
C20orf25, dJ998H6.1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012164
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012164, RRID:AB_1845902
Product name
Anti-CDH22
Provider product page
Atlas Antibodies - HPA012164
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYH
LKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFES
QPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAV
TDVDEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -