Antibody data

Product number
H00010001-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010001-M07, RRID:AB_1136959
Product name
MED6 monoclonal antibody (M07), clone 4C2
Provider product page
Abnova Corporation - H00010001-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MED6.
Antigen sequence
MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSE
RSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYIL
LHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVI
YQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYH
PSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQ
RVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKE
AEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL
Q
Isotype
IgG
Antibody clone number
4C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -