HPA015715

CD226 antibody from Sigma-Aldrich
DNAM-1, DNAM1, PTA1, TLiSA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015715
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015715, RRID:AB_1846278
Product name
Anti-CD226 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015715
Antibody type
Polyclonal
Antigen
CD226 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPS
NSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPR
QIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSV
IVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVA
EGKTDNQYTL
Storage
-20C
Provider Type Product Number
- No reagents -