HPA015715

antibody from Atlas Antibodies

Targeting: CD226 DNAM-1, DNAM1, PTA1, TLiSA1

Antibody data

Submit

Validation data

Product number: HPA015715 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015715, RRID:AB_1846278
Product name: Anti-CD226
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPS NSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPR QIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSV IVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVA EGKTDNQYTL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD226 protein structure - HPA015715 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA015715 antibody. Corresponding CD226 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in cells outside reaction centra.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows moderate positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN