HPA011420

KCNE4 antibody from Sigma-Aldrich
MiRP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011420
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011420, RRID:AB_1079170
Product name
Anti-KCNE4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011420
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily E member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQV
PLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPD
VHLTIQEEGADDELEETSETPLNESSEGSSEN
Storage
-20C
Provider Type Product Number
- No reagents -