HPA029595

SBSPON antibody from MilliporeSigma / Merck KGaA
C8orf84, RPESP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029595
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029595, RRID:AB_10600763
Product name
Anti-C8orf84 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029595
Antibody type
Polyclonal
Antigen
RPE-spondin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARP
CFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGG
Storage
-20C
Provider Type Product Number
- No reagents -