HPA012723

TGOLN2 antibody from Sigma-Aldrich
TGN38, TGN46, TGN48, TGN51, TTGN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012723, RRID:AB_1857975
Product name
Anti-TGOLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012723
Antibody type
Polyclonal
Antigen
Trans-Golgi network integral membrane protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKS
GAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNK
ELPKADTNQLADKGKLSPHAFKTESGEETDLISPP
QEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEK
EKMSGSAS
Storage
-20C
Provider Type Product Number
- No reagents -