HPA015718

DIPK1A antibody from MilliporeSigma / Merck KGaA
FAM69A, FLJ23493
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015718
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015718, RRID:AB_1848405
Product name
Anti-FAM69A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015718
Antibody type
Polyclonal
Antigen
Protein FAM69A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDL
DCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLL
KDYLLRGAPSEIREELEKQLYSCIALKVTANQMEM
EHSLILNNL
Storage
-20C
Provider Type Product Number
- No reagents -