HPA072091

PTPN5 antibody from Atlas Antibodies
PTPSTEP, STEP, STEP61

Antibody data

Product number
HPA072091
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA072091, RRID:AB_2686487
Product name
Anti-PTPN5
Provider product page
Atlas Antibodies - HPA072091
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEI
TVQKVIHTEDYRLRLISLKSGTEERGLKHY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -