HPA025927

RSU1 antibody from Sigma-Aldrich
FLJ31034, RSP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025927, RRID:AB_10610420
Product name
Anti-RSU1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025927
Antibody type
Polyclonal
Antigen
Ras suppressor protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEIL
PPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKE
LHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWV
TPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANP
EPPKKN
Storage
-20C
Provider Type Product Number
- No reagents -