HPA017282

CHODL antibody from Sigma-Aldrich
C21orf68, FLJ12627, MT75, PRED12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017282
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017282, RRID:AB_1846687
Product name
Anti-CHODL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017282
Antibody type
Polyclonal
Antigen
Chondrolectin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNS
QYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYL
YQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTN
QPGDTHQNVVVTEA
Storage
-20C
Provider Type Product Number
- No reagents -