HPA017282

CHODL antibody from Atlas Antibodies
C21orf68, FLJ12627, MT75, PRED12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017282
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017282, RRID:AB_1233863
Product name
Anti-CHODL
Provider product page
Atlas Antibodies - HPA017282
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNS
QYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYL
YQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTN
QPGDTHQNVVVTEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -