HPA015611

TMPRSS15 antibody from Sigma-Aldrich
ENTK, MGC133046, PRSS7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015611
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015611, RRID:AB_1855791
Product name
Anti-PRSS7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015611
Antibody type
Polyclonal
Antigen
Enteropeptidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTN
RMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKA
DHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRF
FNGTTNNNGLVRFRIQSIWHTACAENWT
Storage
-20C
Provider Type Product Number
- No reagents -