HPA015719

WNT7A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015719, RRID:AB_1858856
Product name
Anti-WNT7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015719
Antibody type
Polyclonal
Antigen
Protein Wnt-7a precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELG
YVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSY
RKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACN
KTAPQ
Storage
-20C
Provider Type Product Number
- No reagents -