HPA015719

WNT7A antibody from Atlas Antibodies
Wnt-7a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015719
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015719, RRID:AB_1858856
Product name
Anti-WNT7A
Provider product page
Atlas Antibodies - HPA015719
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELG
YVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSY
RKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACN
KTAPQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -