Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015719 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015719, RRID:AB_1858856
- Product name
- Anti-WNT7A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELG
YVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSY
RKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACN
KTAPQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The microRNA expression signature of bladder cancer by deep sequencing: the functional significance of the miR-195/497 cluster.
A comprehensive analysis of the human placenta transcriptome.
WNT7A regulates tumor growth and progression in ovarian cancer through the WNT/β-catenin pathway.
Itesako T, Seki N, Yoshino H, Chiyomaru T, Yamasaki T, Hidaka H, Yonezawa T, Nohata N, Kinoshita T, Nakagawa M, Enokida H
PloS one 2014;9(2):e84311
PloS one 2014;9(2):e84311
A comprehensive analysis of the human placenta transcriptome.
Saben J, Zhong Y, McKelvey S, Dajani NK, Andres A, Badger TM, Gomez-Acevedo H, Shankar K
Placenta 2014 Feb;35(2):125-31
Placenta 2014 Feb;35(2):125-31
WNT7A regulates tumor growth and progression in ovarian cancer through the WNT/β-catenin pathway.
Yoshioka S, King ML, Ran S, Okuda H, MacLean JA 2nd, McAsey ME, Sugino N, Brard L, Watabe K, Hayashi K
Molecular cancer research : MCR 2012 Mar;10(3):469-82
Molecular cancer research : MCR 2012 Mar;10(3):469-82
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong membrane and cytoplasmic positivity in cells in seminiferus ducts.
- Sample type
- HUMAN