Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003397-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003397-M04, RRID:AB_606428
- Product name
- ID1 monoclonal antibody (M04), clone 4G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ID1.
- Antigen sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCL
SEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDL
QLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT
AEAACVPADDRILCR- Isotype
- IgG
- Antibody clone number
- 4G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma.
Phi JH, Choi SA, Lim SH, Lee J, Wang KC, Park SH, Kim SK
BMC cancer 2013 Jun 15;13:291
BMC cancer 2013 Jun 15;13:291
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ID1 monoclonal antibody (M04), clone 4G11 Western Blot analysis of ID1 expression in Y-79 ( Cat # L042V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ID1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol