Antibody data

Product number
H00003397-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003397-M08, RRID:AB_1136948
Product name
ID1 monoclonal antibody (M08), clone 4G7
Provider product page
Abnova Corporation - H00003397-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ID1.
Antigen sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCL
SEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDL
QLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT
AEAACVPADDRILCR
Isotype
IgG
Antibody clone number
4G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -